-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAPK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAPK3 (NP_001339.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DAPK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAPK3 (NP_001339.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05300A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAPK3 |
| Target Synonyms | DLK; ZIP; ZIPK; DAPK3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAPK3 (NP_001339.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGE | Uniprot ID | O43293 |
Uniprot Id
O43293
Target Species
Human
Target Name
DAPK3
Target Full Name
Death-associated protein kinase 3
Target Function
Serine/threonine kinase which is involved in the regulation of apoptosis, autophagy, transcription, translation and actin cytoskeleton reorganization. Involved in the regulation of smooth muscle contraction. Regulates both type I (caspase-dependent) apoptotic and type II (caspase-independent) autophagic cell deaths signal, depending on the cellular setting. Involved in regulation of starvation-induced autophagy. Regulates myosin phosphorylation in both smooth muscle and non-muscle cells. In smooth muscle, regulates myosin either directly by phosphorylating MYL12B and MYL9 or through inhibition of smooth muscle myosin phosphatase (SMPP1M) via phosphorylation of PPP1R12A; the inhibition of SMPP1M functions to enhance muscle responsiveness to Ca(2+) and promote a contractile state. Phosphorylates MYL12B in non-muscle cells leading to reorganization of actin cytoskeleton. Isoform 2 can phosphorylate myosin, PPP1R12A and MYL12B. Overexpression leads to condensation of actin stress fibers into thick bundles. Involved in actin filament focal adhesion dynamics. The function in both reorganization of actin cytoskeleton and focal adhesion dissolution is modulated by RhoD. Positively regulates canonical Wnt/beta-catenin signaling through interaction with NLK and TCF7L2. Phosphorylates RPL13A on 'Ser-77' upon interferon-gamma activation which is causing RPL13A release from the ribosome, RPL13A association with the GAIT complex and its subsequent involvement in transcript-selective translation inhibition. Enhances transcription from AR-responsive promoters in a hormone- and kinase-dependent manner. Involved in regulation of cell cycle progression and cell proliferation. May be a tumor suppressor.
Target Subcellular Location
Nucleus. Cytoplasm.; [Isoform 1]: Nucleus. Cytoplasm.; [Isoform 2]: Nucleus. Cytoplasm.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily
Target Tissue Specificity
Widely expressed. Isoform 1 and isoform 2 are expressed in the bladder smooth muscle.
Target Synonyms
DAP kinase 3; DAP like kinase; DAP-like kinase; Dapk 3; DAPK3; DAPK3_HUMAN; Death associated kinase 3; Death associated protein kinase 3; Death-associated protein kinase 3; Dlk; EC 2.7.11.1; FLJ36473; MYPT1 kinase; ZIP; ZIP kinase ; ZIP kinase isoform; ZIP-kinase; ZIPK; zipper-interacting protein kinase
Target Background
Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis.
Notification