Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DARPP32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DARPP32 (NP_115568.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DARPP32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DARPP32 (NP_115568.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04326A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DARPP32 |
| Target Synonyms | DARPP32; DARPP-32 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DARPP32 (NP_115568.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGY | Uniprot ID | Q9UD71 |
Uniprot Id
Q9UD71
Target Species
Human
Target Name
PPP1R1B
Target Full Name
Protein phosphatase 1 regulatory subunit 1B
Target Function
Inhibitor of protein-phosphatase 1.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein phosphatase inhibitor 1 family
Target Research Area
Neuroscience
Target Synonyms
DARPP 32; DARPP-32; Dopamine and cAMP regulated neuronal phosphoprotein 32; Dopamine and cAMP regulated neuronal phosphoprotein; Dopamine and cAMP regulated phosphoprotein; Dopamine and cAMP regulated phosphoprotein DARPP 32 ; Dopamine and cAMP regulated phosphoprotein DARPP32; Dopamine- and cAMP-regulated neuronal phosphoprotein; FLJ20940; IPPD; Neuronal phosphoprotein DARPP 32; PPP1R1B; PPR1B_HUMAN; Protein phosphatase 1 regulatory (inhibitor) subunit 1B; Protein phosphatase 1 regulatory inhibitor subunit 1B; Protein phosphatase 1 regulatory subunit 1B
Target Background
This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
