-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAZ2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DAZ2 (NP_001005785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DAZ2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DAZ2 (NP_001005785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02410A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAZ2 |
| Target Synonyms | pDP1678; DAZ2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DAZ2 (NP_001005785.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAF | Uniprot ID | Q13117 |
Uniprot Id
Q13117
Target Species
Human
Target Name
DAZ2
Target Full Name
Deleted in azoospermia protein 2
Target Function
RNA-binding protein that plays an essential role in spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation.
Target Involvement
Spermatogenic failure Y-linked 2 (SPGFY2)
Target Subcellular Location
Cytoplasm. Nucleus. Note=Predominantly cytoplasmic. Nuclear at some stages of spermatozoide development. Localizes both to the nuclei and cytoplasm of spermatozoide differentiation. Nuclear in fetal gonocytes and in spermatogonial nuclei. It then relocates to the cytoplasm during male meiosis.
Target Protein Families
RRM DAZ family
Target Tissue Specificity
Testis specific.
Target Synonyms
DAZ2; DAZ2_HUMAN; DAZ3; Deleted in azoospermia 2; Deleted in azoospermia protein 2; Deleted in azoospermia protein 3; MGC126442; pDP1678
Target Background
This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains one copy of the 10.8 kb repeat. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification