-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAZAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-407 of human DAZAP1 (Q96EP5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DAZAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-407 of human DAZAP1 (Q96EP5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13278A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAZAP1 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | HeLa, K-562, Mouse testis, Rat testis, U-251MG |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 265-407 of human DAZAP1 (Q96EP5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR | Uniprot ID | Q96EP5 |
Uniprot Id
Q96EP5
Target Species
Human
Target Name
DAZAP1
Target Full Name
DAZ-associated protein 1
Target Function
RNA-binding protein, which may be required during spermatogenesis.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Mainly expressed in testis. Expressed to a lower level in thymus. Weakly or not expressed in heart, liver, brain, placenta, lung, skeletal muscle, kidney and pancreas.
Target Synonyms
DAZ associated protein 1; DAZ-associated protein 1; Dazap1; DAZP1_HUMAN; Deleted in azoospermia associated protein 1; Deleted in azoospermia-associated protein 1
Target Background
In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.
Notification