-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DBH was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-200 of human DBH (NP_958852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DBH was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-200 of human DBH (NP_958852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09853A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DBH |
| Target Synonyms | DBM; ORTHYP1; DBH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-200 of human DBH (NP_958852.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTL | Uniprot ID | P09172 |
Uniprot Id
P09172
Target Species
Human
Target Name
DBH
Target Full Name
Dopamine beta-hydroxylase
Target Function
Conversion of dopamine to noradrenaline.
Target Involvement
Dopamine beta-hydroxylase deficiency (DBH deficiency)
Target Subcellular Location
[Soluble dopamine beta-hydroxylase]: Cytoplasmic vesicle, secretory vesicle lumen. Cytoplasmic vesicle, secretory vesicle, chromaffin granule lumen. Secreted.; Cytoplasmic vesicle, secretory vesicle membrane; Single-pass type II membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass type II membrane protein.
Target Protein Families
Copper type II ascorbate-dependent monooxygenase family
Target Research Area
Neuroscience
Target Synonyms
dbh; DBM; Dopamine beta hydroxylase; Dopamine beta monooxygenase; Dopamine beta-hydroxylase (dopamine beta-monooxygenase); Dopamine beta-monooxygenase; DOPO_HUMAN; OTTHUMP00000022501; Soluble dopamine beta-hydroxylase
Target Background
The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. The encoded protein, expressed in neuroscretory vesicles and chromaffin granules of the adrenal medulla, catalyzes the conversion of dopamine to norepinephrine, which functions as both a hormone and as the main neurotransmitter of the sympathetic nervous system. The enzyme encoded by this gene exists exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide. Mutations in this gene cause dopamine beta-hydroxylate deficiency in human patients, characterized by deficits in autonomic and cardiovascular function, including hypotension and ptosis. Polymorphisms in this gene may play a role in a variety of psychiatric disorders.
Notification