Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCAF12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human DCAF12 (NP_056212.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCAF12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human DCAF12 (NP_056212.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00245A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCAF12 |
| Target Synonyms | CT102; TCC52; WDR40A; KIAA1892; DCAF12 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human DCAF12 (NP_056212.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFH | Uniprot ID | Q5T6F0 |
Uniprot Id
Q5T6F0
Target Species
Human
Target Name
DCAF12
Target Full Name
DDB1- and CUL4-associated factor 12
Target Function
Substrate-recognition component of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation. The C-degron recognized by the DesCEND pathway is usually a motif of less than ten residues and can be present in full-length proteins, truncated proteins or proteolytically cleaved forms. The DCX(DCAF12) complex specifically recognizes proteins with a diglutamate (Glu-Glu) at the C-terminus, such as MAGEA3, MAGEA6 and CCT5, leading to their ubiquitination and degradation. Ubiquitination of MAGEA3, MAGEA6 by DCX(DCAF12) complex is required for starvation-induced autophagy
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
WD repeat DCAF12 family
Target Tissue Specificity
Highly expressed in lung cancer tissues and some cancer cell lines. Restricted expression in normal testis.
Target Synonyms
cancer/testis antigen 102; Centrosome-related protein TCC52; CT102; DCA12_HUMAN; DCAF12; DDB1- and CUL4-associated factor 12; DKFZP434O125; KIAA1892; MGC1058; TCC52; Testis cancer centrosome-related protein; WD repeat domain 40A; WD repeat-containing protein 40A; WDR40A
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
