-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCAF7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human DCAF7 (P61962) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DCAF7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human DCAF7 (P61962) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13451A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCAF7 |
| Target Synonyms | AN11; HAN11; WDR68; SWAN-1; DCAF7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat kidney, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human DCAF7 (P61962). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMP | Uniprot ID | P61962 |
Uniprot Id
P61962
Target Species
Human
Target Name
DCAF7
Target Full Name
DDB1- and CUL4-associated factor 7
Target Function
Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Overexpression of DIAHP1 or active RHOA causes translocation from the nucleus to cytoplasm.
Target Protein Families
WD repeat DCAF7 family
Target Research Area
Signal Transduction
Target Synonyms
AN11; Dcaf7; DCAF7_HUMAN; DDB1- and CUL4-associated factor 7; HAN11 ; Human anthocyanin; Petunia; Seven WD repeat protein of the AN11 family 1; SWAN 1; WD repeat domain 68; WD repeat protein An11 homolog ; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; WDR68
Target Background
This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in kinase signaling. This highly conserved gene is present in eukaryotic plants, fungi, and animals. The ortholog of this gene was first identified in plants as a key regulator of anthocyanin biosynthesis and flower pigmentation. Alternative splicing results in multiple transcript variants.
Notification