Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCTD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human DCTD (NP_001912.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DCTD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human DCTD (NP_001912.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03633A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCTD |
| Target Synonyms | DCTD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human DCTD (NP_001912.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ | Uniprot ID | P32321 |
Uniprot Id
P32321
Target Species
Human
Target Name
DCTD
Target Full Name
Deoxycytidylate deaminase
Target Function
Supplies the nucleotide substrate for thymidylate synthetase.
Target Protein Families
Cytidine and deoxycytidylate deaminase family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
dCMP deaminase; dctD; DCTD_HUMAN; Deoxycytidylate deaminase; MGC111062
Target Background
The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
