Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCTN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-401 of human DCTN2 (NP_006391.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCTN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-401 of human DCTN2 (NP_006391.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using DCTN2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-00618A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCTN2 |
| Target Synonyms | RBP50; DCTN50; HEL-S-77; DYNAMITIN; DCTN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 280-401 of human DCTN2 (NP_006391.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERM | Uniprot ID | Q13561 |
Uniprot Id
Q13561
Target Species
Human
Target Name
DCTN2
Target Full Name
Dynactin subunit 2
Target Function
Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Membrane; Peripheral membrane protein.
Target Protein Families
Dynactin subunit 2 family
Target Synonyms
50 kD dynein associated polypeptide ; 50 kDa dynein associated polypeptide ; 50 kDa dynein-associated polypeptide; DCTN-50; DCTN2; DCTN2_HUMAN; DCTN50 ; dynactin 2 (p50) ; dynactin 2; dynactin complex 50 kD subunit ; Dynactin complex 50 kDa subunit; Dynactin subunit 2; DYNAMITIN; p50 dynamitin; RBP50
Target Background
This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
