Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCTN5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human DCTN5 (Q9BTE1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCTN5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human DCTN5 (Q9BTE1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14372A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCTN5 |
| Target Synonyms | DCTN5; dynactin subunit 5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human DCTN5 (Q9BTE1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV | Uniprot ID | Q9BTE1 |
Uniprot Id
Q9BTE1
Target Species
Human
Target Name
DCTN5
Target Full Name
Dynactin subunit 5
Target Subcellular Location
Cytoplasm, cytoskeleton. Chromosome, centromere, kinetochore.
Target Protein Families
Dynactin subunits 5/6 family, Dynactin subunit 5 subfamily
Target Synonyms
DCTN 5; DCTN5; DCTN5_HUMAN; Dynactin 4; Dynactin 5 (p25); Dynactin subunit 5; Dynactin subunit p25; p25
Target Background
This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
