-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCUN1D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-70 of human DCUN1D1 (NP_065691.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCUN1D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-70 of human DCUN1D1 (NP_065691.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00634A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCUN1D1 |
| Target Synonyms | RP42; SCRO; Tes3; DCNL1; SCCRO; DCUN1L1; DCUN1D1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, A-549, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 15-70 of human DCUN1D1 (NP_065691.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN | Uniprot ID | Q96GG9 |
Uniprot Id
Q96GG9
Target Species
Human
Target Name
DCUN1D1
Target Full Name
DCN1-like protein 1
Target Function
Part of an E3 ubiquitin ligase complex for neddylation. Promotes neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes. Acts by binding to cullin-RBX1 complexes in the cytoplasm and promoting their nuclear translocation, enhancing recruitment of E2-NEDD8 (UBE2M-NEDD8) thioester to the complex, and optimizing the orientation of proteins in the complex to allow efficient transfer of NEDD8 from the E2 to the cullin substrates. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Expressed in pancreas, kidney, placenta, brain and heart. Weakly or not expressed in liver, skeletal muscle and lung. Strongly overexpressed in thyroid tumors, bronchioloalveolar carcinomas, and malignant tissues of squamous cell carcinoma of the oral ton
Target Research Area
Cancer
Target Synonyms
DCUN1D1; DCN1; DCUN1L1; RP42; SCCRODCN1-like protein 1; DCUN1 domain-containing protein 1; Defective in cullin neddylation protein 1-like protein 1; Squamous cell carcinoma-related oncogene
Target Background
Enables cullin family protein binding activity. Involved in positive regulation of protein neddylation and regulation of protein ubiquitination. Located in cytosol and nucleoplasm. Part of ubiquitin ligase complex.
Notification