Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDAH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDAH2 (O95865) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DDAH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDAH2 (O95865) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13833A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDAH2 |
| Target Synonyms | G6a; DDAH; NG30; DDAHII; HEL-S-277; DDAH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, HepG2, Mouse brain, Mouse lung, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDAH2 (O95865). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEV | Uniprot ID | O95865 |
Uniprot Id
O95865
Target Species
Human
Target Name
DDAH2
Target Full Name
Putative hydrolase DDAH2
Target Function
Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Target Subcellular Location
Cytoplasm. Mitochondrion. Note=Translocates from cytosol to mitochondrion upon IL-1beta stimulation in chondrocytes.
Target Protein Families
DDAH family
Target Tissue Specificity
Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain.
Target Research Area
Neuroscience
Target Synonyms
DDAH; DDAH II; DDAH-2; DDAH2; DDAH2_HUMAN; DDAHII; Dimethylargininase 2; Dimethylargininase-2; Dimethylarginine dimethylaminohydrolase 2; Dimethylarginine dimethylaminohydrolase II; G6a; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; NG dimethylarginine dimethylamino hydrolase homolog; NG30; OTTHUMP00000029307; OTTHUMP00000029310; OTTHUMP00000174488; OTTHUMP00000174489; Protein G6a; S phase protein; S-phase protein
Target Background
This gene encodes a dimethylarginine dimethylaminohydrolase. The encoded enzyme functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
