-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDX28 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 371-540 of human DDX28 (NP_060850.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DDX28 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 371-540 of human DDX28 (NP_060850.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07054A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDX28 |
| Target Synonyms | MDDX28; DDX28 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 371-540 of human DDX28 (NP_060850.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT | Uniprot ID | Q9NUL7 |
Uniprot Id
Q9NUL7
Target Species
Human
Target Name
DDX28
Target Full Name
Probable ATP-dependent RNA helicase DDX28
Target Function
Plays an essential role in facilitating the proper assembly of the mitochondrial large ribosomal subunit and its helicase activity is essential for this function. May be involved in RNA processing or transport. Has RNA and Mg(2+)-dependent ATPase activity.
Target Subcellular Location
Nucleus. Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid. Mitochondrion matrix.
Target Protein Families
DEAD box helicase family
Target Tissue Specificity
Expressed in all tissues tested, including brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, leukocytes, colon, small intestine, ovary and prostate.
Target Synonyms
DDX 28; DDX28; DDX28_HUMAN; DEAD (Asp Glu Ala Asp) box polypeptide 28; DEAD box polypeptide 28; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 28; FLJ11282; MDDX 28; MDDX28; Mitochondrial DEAD box protein 28; Probable ATP-dependent RNA helicase DDX28
Target Background
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is intronless. It encodes an RNA-dependent ATPase. The encoded protein is localized in the mitochondria and the nucleus, and can be transported between the mitochondria and the nucleus.
Notification