-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDX39A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX39A (NP_005795.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DDX39A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX39A (NP_005795.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-01854A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDX39A |
| Target Synonyms | BAT1; DDXL; BAT1L; DDX39; URH49; DDX39A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Mouse liver, Mouse spleen, Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX39A (NP_005795.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVL | Uniprot ID | O00148 |
Uniprot Id
O00148
Target Species
Human
Target Name
DDX39A
Target Full Name
ATP-dependent RNA helicase DDX39A
Target Function
Involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Can translocate to the cytoplasm in the presence of MX1.
Target Protein Families
DEAD box helicase family, DECD subfamily
Target Tissue Specificity
Detected in testis, and at lower levels in brain, kidney, lung, thymus, spleen and salivary gland.
Target Synonyms
DDX39A; DDX39; ATP-dependent RNA helicase DDX39A; EC 3.6.4.13; DEAD box protein 39; Nuclear RNA helicase URH49
Target Background
This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is thought to play a role in the prognosis of patients with gastrointestinal stromal tumors. A pseudogene of this gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Notification