-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX5 (P17844) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against DDX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX5 (P17844) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-16562A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDX5 |
| Target Synonyms | p68; HLR1; G17P1; HUMP68; DDX5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX5 (P17844). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEAN | Uniprot ID | P17844 |
Uniprot Id
P17844
Target Species
Human
Target Name
DDX5
Target Full Name
Probable ATP-dependent RNA helicase DDX5
Target Function
Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for androgen receptor AR but probably not ESR1. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specific manner; the function probably involves association with histone deacetylases, such as HDAC1. As component of a large PER complex is involved in the inhibition of 3' transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Cytoplasm.
Target Protein Families
DEAD box helicase family, DDX5/DBP2 subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ATP dependent RNA helicase DDX5; DDX 5; Ddx5; DDX5_HUMAN; DEAD (Asp Glu Ala Asp) box helicase 5; DEAD (Asp Glu Ala Asp) box polypeptide 5; DEAD box 5; DEAD box protein 5; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 5 (RNA helicase; 68kD); G17P1; HELR; HLR1; HUMP68; P68; p68 RNA helicase; Probable ATP dependent RNA helicase DDX5; Probable ATP-dependent RNA helicase DDX5; RNA helicase p68
Target Background
This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants.
Notification