-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDX6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 384-483aa of human DDX6 (NP_001244120.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DDX6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 384-483aa of human DDX6 (NP_001244120.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10439A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDX6 |
| Target Synonyms | P54; RCK; HLR2; IDDILF; Rck/p54; DDX6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, HepG2, Rat spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 384-483aa of human DDX6 (NP_001244120.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP | Uniprot ID | P26196 |
Uniprot Id
P26196
Target Species
Human
Target Name
DDX6
Target Full Name
Probable ATP-dependent RNA helicase DDX6
Target Function
Essential for the formation of P-bodies, cytosolic membrane-less ribonucleoprotein granules involved in RNA metabolism through the coordinated storage of mRNAs encoding regulatory functions. Plays a role in P-bodies to coordinate the storage of translationally inactive mRNAs in the cytoplasm and prevent their degradation. In the process of mRNA degradation, plays a role in mRNA decapping. Blocks autophagy in nutrient-rich conditions by repressing the expression of ATG-related genes through degradation of their transcripts.
Target Involvement
A chromosomal aberration involving DDX6 may be a cause of hematopoietic tumors such as B-cell lymphomas. Translocation t(11;14)(q23;q32).
Target Subcellular Location
Cytoplasm, P-body. Cytoplasm. Nucleus.
Target Protein Families
DEAD box helicase family, DDX6/DHH1 subfamily
Target Tissue Specificity
Abundantly expressed in most tissues.
Target Synonyms
DDX6; HLR2; RCK; Probable ATP-dependent RNA helicase DDX6; EC 3.6.4.13; ATP-dependent RNA helicase p54; DEAD box protein 6; Oncogene RCK
Target Background
This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification