-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DENN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1548-1647 of human DENN (Q8WXG6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DENN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1548-1647 of human DENN (Q8WXG6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13326A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DENN |
| Target Synonyms | DENN; IG20; DEEAH; RabGEF; NEDDISH; RAB3GEP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1548-1647 of human DENN (Q8WXG6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQDLKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS | Uniprot ID | Q8WXG6 |
Uniprot Id
Q8WXG6
Target Species
Human
Target Name
MADD
Target Full Name
MAP kinase-activating death domain protein
Target Function
Guanyl-nucleotide exchange factor that regulates small GTPases of the Rab family. Converts GDP-bound inactive form of RAB27A and RAB27B to the GTP-bound active forms. Converts GDP-bound inactive form of RAB3A, RAB3C and RAB3D to the GTP-bound active forms, GTPases involved in synaptic vesicle exocytosis and vesicle secretion. Plays a role in synaptic vesicle formation and in vesicle trafficking at the neuromuscular junction. Involved in upregulating a post-docking step of synaptic exocytosis in central synapses. Probably by binding to the motor proteins KIF1B and KIF1A, mediates motor-dependent transport of GTP-RAB3A-positive vesicles to the presynaptic nerve terminals. Plays a role in TNFA-mediated activation of the MAPK pathway, including ERK1/2. May link TNFRSF1A with MAP kinase activation. May be involved in the regulation of TNFA-induced apoptosis.
Target Subcellular Location
Cell membrane. Cytoplasm. Cell projection, axon.
Target Protein Families
MADD family
Target Tissue Specificity
Expressed in testis, ovary, brain and heart. Expressed in spleen, thymus, prostate, testis, ovary, small instestine and colon. Expressed in liver.; [Isoform 1]: Not detected in the brain, breast, kidney, lung, ovary, pancreas, testis, uterus, stomach and
Target Synonyms
Differentially expressed in normal and neoplastic cells; FLJ35600; IG20 ; Insulinoma glucagonoma clone 20; KIAA0358 ; MADD; MADD_HUMAN; MAP kinase-activating death domain protein; Rab3 GDP/GTP exchange factor; RAB3GEP
Target Background
Tumor necrosis factor alpha (TNF-alpha) is a signaling molecule that interacts with one of two receptors on cells targeted for apoptosis. The apoptotic signal is transduced inside these cells by cytoplasmic adaptor proteins. The protein encoded by this gene is a death domain-containing adaptor protein that interacts with the death domain of TNF-alpha receptor 1 to activate mitogen-activated protein kinase (MAPK) and propagate the apoptotic signal. It is membrane-bound and expressed at a higher level in neoplastic cells than in normal cells. Several transcript variants encoding different isoforms have been described for this gene.
Notification