Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Destrin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human Destrin (NP_006861.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Destrin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human Destrin (NP_006861.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01979A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Destrin |
| Target Synonyms | ADF; ACTDP; HEL32; bA462D18.2; Destrin | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human Destrin (NP_006861.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV | Uniprot ID | P60981 |
Uniprot Id
P60981
Target Species
Human
Target Name
DSTN
Target Full Name
Destrin
Target Function
Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (G-actin). Acts in a pH-independent manner.
Target Protein Families
Actin-binding proteins ADF family
Target Tissue Specificity
Widely distributed in various tissues.
Target Synonyms
2610043P17Rik; ACTDP; Actin depolymerizing factor; Actin-depolymerizing factor; ADF; AU042046; bA462D18.2; corn1; DEST_HUMAN; Destrin (actin depolymerizing factor); Destrin; DSN; Dstn; Epididymis luminal protein 32; HEL32; Sid 23; sid23p
Target Background
The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
