-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DGAT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-388 of human DGAT2 (NP_115953.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DGAT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 289-388 of human DGAT2 (NP_115953.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12368A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DGAT2 |
| Target Synonyms | ARAT; HMFN1045; GS1999FULL; DGAT2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF-7, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 289-388 of human DGAT2 (NP_115953.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN | Uniprot ID | Q96PD7 |
Uniprot Id
Q96PD7
Target Species
Human
Target Name
DGAT2
Target Full Name
Diacylglycerol O-acyltransferase 2
Target Function
Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT). Also able to use 1-monoalkylglycerol (1-MAkG) as an acyl acceptor for the synthesis of monoalkyl-monoacylglycerol (MAMAG).
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet. Cytoplasm, perinuclear region.
Target Protein Families
Diacylglycerol acyltransferase family
Target Tissue Specificity
Predominantly expressed in liver and white adipose tissue. Expressed at lower level in mammary gland, testis and peripheral blood leukocytes. Expressed in sebaceous glands of normal skin but decreased psoriatic skin.
Target Synonyms
DGAT2; HMFN1045; UNQ738/PRO1433; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2
Target Background
This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification