-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DGKD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 960-1140 of human DGKD (NP_690618.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DGKD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 960-1140 of human DGKD (NP_690618.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05267A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DGKD |
| Target Synonyms | dgkd-2; DGKdelta; DGK-delta; DGKD | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 960-1140 of human DGKD (NP_690618.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGA | Uniprot ID | Q16760 |
Uniprot Id
Q16760
Target Species
Human
Target Name
DGKD
Target Full Name
Diacylglycerol kinase delta
Target Function
Diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids. Thereby, acts as a central switch between the signaling pathways activated by these second messengers with different cellular targets and opposite effects in numerous biological processes (Probable). By controlling the levels of diacylglycerol, regulates for instance the PKC and EGF receptor signaling pathways and plays a crucial role during development. May also regulate clathrin-dependent endocytosis.
Target Subcellular Location
Membrane, clathrin-coated pit. Cytoplasm.; [Isoform 1]: Cell membrane; Peripheral membrane protein. Cytoplasm.
Target Protein Families
Eukaryotic diacylglycerol kinase family
Target Tissue Specificity
[Isoform 2]: Widely expressed.; [Isoform 1]: Only detected in ovary, and to a lesser extent in spleen.
Target Synonyms
DGKD; KIAA0145Diacylglycerol kinase delta; DAG kinase delta; EC 2.7.1.107; 130 kDa diacylglycerol kinase; Diglyceride kinase delta; DGK-delta
Target Background
This gene encodes a cytoplasmic enzyme that phosphorylates diacylglycerol to produce phosphatidic acid. Diacylglycerol and phosphatidic acid are two lipids that act as second messengers in signaling cascades. Their cellular concentrations are regulated by the encoded protein, and so it is thought to play an important role in cellular signal transduction. Alternative splicing results in two transcript variants encoding different isoforms.
Notification