-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DHDDS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human DHDDS (NP_995583.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DHDDS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human DHDDS (NP_995583.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01918A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DHDDS |
| Target Synonyms | DS; CIT; CPT; HDS; RP59; hCIT; DEDSM; DHDDS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse testis, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human DHDDS (NP_995583.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHP | Uniprot ID | Q86SQ9 |
Uniprot Id
Q86SQ9
Target Species
Human
Target Name
DHDDS
Target Full Name
Dehydrodolichyl diphosphate synthase complex subunit DHDDS
Target Function
With NUS1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Both subunits contribute to enzymatic activity, i.e. condensation of multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol phosphate which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Synthesizes long-chain polyprenols, mostly of C95 and C100 chain length. Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol.
Target Involvement
Retinitis pigmentosa 59 (RP59)
Target Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein. Note=colocalizes with calnexin.
Target Protein Families
UPP synthase family
Target Tissue Specificity
Expressed at high levels in testis and kidney. Expressed in epididymis (at protein level). Slightly expressed in heart, spleen and thymus.
Target Research Area
others
Target Synonyms
DHDDS; HDSDehydrodolichyl diphosphate synthase complex subunit DHDDS; EC 2.5.1.87; Cis-isoprenyltransferase; CIT; Cis-IPTase; Cis-prenyltransferase subunit hCIT; Epididymis tissue protein Li 189m
Target Background
The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification