-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DIAPH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DIAPH2 (NP_009293.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DIAPH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DIAPH2 (NP_009293.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01334A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DIAPH2 |
| Target Synonyms | DIA; POF; DIA2; DRF2; POF2; POF2A; DIAPH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, LO2, Mouse liver, NCI-H460, Rat liver, SKOV3, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DIAPH2 (NP_009293.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN | Uniprot ID | O60879 |
Uniprot Id
O60879
Target Species
Human
Target Name
DIAPH2
Target Full Name
Protein diaphanous homolog 2
Target Function
Could be involved in oogenesis. Involved in the regulation of endosome dynamics. Implicated in a novel signal transduction pathway, in which isoform 3 and CSK are sequentially activated by RHOD to regulate the motility of early endosomes through interactions with the actin cytoskeleton.
Target Involvement
Premature ovarian failure 2A (POF2A)
Target Subcellular Location
[Isoform 3]: Cytoplasm, cytosol. Early endosome. Note=Isoform 3 is cytosolic but when coexpressed with RHOD, the 2 proteins colocalize to early endosomes.
Target Protein Families
Formin homology family, Diaphanous subfamily
Target Tissue Specificity
Expressed in testis, ovary, small intestine, prostate, lung, liver, kidney and leukocytes.
Target Synonyms
Dia 2; DIA; Dia drome; Dia2; Diap 2; Diap2; DIAP2_HUMAN; DIAPH 2; Diaph2; Diaphanous 2; Diaphanous homolog 2 (Drosophila); Diaphanous homolog 2; Diaphanous related formin 2; Diaphanous-related formin-2; Diaphanous2; Diaphorase 2; Diaphorase2; DRF 2; DRF2; FLJ11167; OTTHUMP00000024270; OTTHUMP00000024271; OTTHUMP00000062171; POF 2; POF; POF2; Protein diaphanous homolog 2
Target Background
The product of this gene belongs to the diaphanous subfamily of the formin homology family of proteins. This gene may play a role in the development and normal function of the ovaries. Defects in this gene have been linked to premature ovarian failure 2. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification