-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DIMT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human DIMT1 (NP_055288.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DIMT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human DIMT1 (NP_055288.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02415A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DIMT1 |
| Target Synonyms | DIM1; DIMT1L; HUSSY5; HSA9761; DIMT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, H460, K-562, MCF7, Mouse spleen, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human DIMT1 (NP_055288.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV | Uniprot ID | Q9UNQ2 |
Uniprot Id
Q9UNQ2
Target Species
Human
Target Name
DIMT1
Target Full Name
Dimethyladenosine transferase
Target Function
Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA in the 40S particle. Involved in the pre-rRNA processing steps leading to small-subunit rRNA production independently of its RNA-modifying catalytic activity.
Target Subcellular Location
Nucleus, nucleoplasm. Nucleus, nucleolus.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, rRNA adenine N(6)-methyltransferase family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase; 18S rRNA dimethylase; DIM1; DIM1 dimethyladenosine transferase 1 homolog (S. cerevisiae); DIM1 dimethyladenosine transferase 1 homolog; DIM1 dimethyladenosine transferase 1 like ; DIM1 dimethyladenosine transferase 1-like; Dimethyladenosine transferase; DIMT1; DIMT1_HUMAN; DIMT1L; HSA9761; HUSSY5; N''-adenosyl(rRNA) dimethyltransferase; Probable 18S rRNA (adenine(1779) N(6)/adenine(1780) N(6)) dimethyltransferase; Probable 18S rRNA dimethylase; Probable dimethyladenosine transferase; Probable S adenosylmethionine 6 N',N' adenosyl(rRNA) dimethyltransferase; S adenosylmethionine 6 N',N' adenosyl(rRNA) dimethyltransferase; S-adenosylmethionine-6-N''
Target Background
The protein encoded by this gene is a methyltransferase that is responsible for dimethylation of adjacent adenosines near the 18S rRNA decoding site. The encoded protein is essential for ribosome biogenesis, although its catalytic activity is not involved in the process. The yeast ortholog of this protein functions in the cytoplasm while this protein functions in the nucleus.
Notification