-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DIO3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human DIO3 (NP_001353.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DIO3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human DIO3 (NP_001353.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09413A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DIO3 |
| Target Synonyms | D3; 5DIII; TXDI3; DIOIII; DIO3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human DIO3 (NP_001353.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTU | Uniprot ID | P55073 |
Uniprot Id
P55073
Target Species
Human
Target Name
DIO3
Target Full Name
Thyroxine 5-deiodinase
Target Function
Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein.
Target Protein Families
Iodothyronine deiodinase family
Target Tissue Specificity
Expressed in placenta and several fetal tissues.
Target Synonyms
5DIII; D3; Deiodinase iodothyronine type 3; Deiodinase iodothyronine type III; Dio 3; Dio3; DIOIII; IOD3_HUMAN; Iodothyronine deiodinase placental type; MGC124117; MGC124118; Thyroxine deiodinase type III ; Thyroxine deiodinase type III (selenoprotein); TXDI3; Type 3 DI; Type 3 iodothyronine selenodeiodinase; Type III 5' deiodinase; Type III iodothyronine deiodinase; Type-III 5''-deiodinase
Target Background
The protein encoded by this intronless gene belongs to the iodothyronine deiodinase family. It catalyzes the inactivation of thyroid hormone by inner ring deiodination of the prohormone thyroxine (T4) and the bioactive hormone 3, 3', 5-triiodothyronine (T3) to inactive metabolites, 3, 3', 5'-triiodothyronine (RT3) and 3, 3'-diiodothyronine (T2), respectively. This enzyme is highly expressed in pregnant uterus, placenta, fetal and neonatal tissues, and thought to prevent premature exposure of developing fetal tissues to adult levels of thyroid hormones. It regulates circulating fetal thyroid hormone concentrations, and thus plays a critical role in mammalian development. Knockout mice lacking this gene exhibit abnormalities related to development and reproduction, and increased activity of this enzyme in infants with hemangiomas causes severe hypothyroidism. This protein is a selenoprotein, containing the rare selenocysteine (Sec) amino acid at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal.
Notification