-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DISC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DISC1 (Q9NRI5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DISC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DISC1 (Q9NRI5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16074A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DISC1 |
| Target Synonyms | SCZD9; C1orf136; DISC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat brain, Rat heart, MCF7, Mouse brain, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DISC1 (Q9NRI5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVS | Uniprot ID | Q9NRI5 |
Uniprot Id
Q9NRI5
Target Species
Human
Target Name
DISC1
Target Full Name
Disrupted in schizophrenia 1 protein
Target Function
Involved in the regulation of multiple aspects of embryonic and adult neurogenesis. Required for neural progenitor proliferation in the ventrical/subventrical zone during embryonic brain development and in the adult dentate gyrus of the hippocampus. Participates in the Wnt-mediated neural progenitor proliferation as a positive regulator by modulating GSK3B activity and CTNNB1 abundance. Plays a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including neuron positioning, dendritic development and synapse formation. Inhibits the activation of AKT-mTOR signaling upon interaction with CCDC88A. Regulates the migration of early-born granule cell precursors toward the dentate gyrus during the hippocampal development. Inhibits ATF4 transcription factor activity in neurons by disrupting ATF4 dimerization and DNA-binding. Plays a role, together with PCNT, in the microtubule network formation.
Target Involvement
Schizophrenia 9 (SCZD9)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Mitochondrion. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell junction, synapse, postsynaptic density.
Target Tissue Specificity
Ubiquitous. Highly expressed in the dentate gyrus of the hippocampus. Also expressed in the temporal and parahippocampal cortices and cells of the white matter.
Target Synonyms
C1orf136; DISC1; DISC1_HUMAN; Disrupted in schizophrenia 1; Disrupted in schizophrenia 1 protein; KIAA0457; RP4-730B13.1; SCZD9
Target Background
This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. This gene is disrupted in a t(1;11)(q42.1;q14.3) translocation which segregates with schizophrenia and related psychiatric disorders in a large Scottish family. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification