Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DLST was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human DLST (NP_001924.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DLST was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human DLST (NP_001924.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12682A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DLST |
| Target Synonyms | DLTS; KGD2; PGL7; DLST | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human DLST (NP_001924.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTT | Uniprot ID | P36957 |
Uniprot Id
P36957
Target Species
Human
Target Name
DLST
Target Full Name
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Target Function
Dihydrolipoamide succinyltransferase (E2) component of the 2-oxoglutarate dehydrogenase complex. The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion. A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A.
Target Subcellular Location
Mitochondrion matrix. Nucleus.
Target Protein Families
2-oxoacid dehydrogenase family
Target Synonyms
2-oxoglutarate dehydrogenase complex component E2; Dihydrolipoamide S succinyltransferase (E2 component of 2 oxo glutarate complex); Dihydrolipoamide S succinyltransferase; Dihydrolipoamide succinyltransferase component of 2 oxoglutarate dehydrogenase complex; Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex; Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex; Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex mitochondrial; Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex; Dlst; DLTS; E2; E2K; mitochondrial; ODO2_HUMAN; OGDC-E2
Target Background
This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
