-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DLX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 188-287 of human DLX3 (O60479) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DLX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 188-287 of human DLX3 (O60479) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13309A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DLX3 |
| Target Synonyms | AI4; TDO; DLX3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse placenta, SK-BR-3, T-47D | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 188-287 of human DLX3 (O60479). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY | Uniprot ID | O60479 |
Uniprot Id
O60479
Target Species
Human
Target Name
DLX3
Target Full Name
Homeobox protein DLX-3
Target Function
Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis.
Target Involvement
Trichodentoosseous syndrome (TDO); Amelogenesis imperfecta 4 (AI4)
Target Subcellular Location
Nucleus.
Target Protein Families
Distal-less homeobox family
Target Synonyms
AI4; Distal less homeo box 3; DLX 3; Dlx3; DLX3 distalless homeobox 3; DLX3_HUMAN; Homeobox protein DLX 3; Homeobox protein DLX-3; Homeobox protein Dlx3; TDO
Target Background
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.
Notification