-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DLX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human DLX5 (NP_005212.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DLX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human DLX5 (NP_005212.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05299A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DLX5 |
| Target Synonyms | SHFM1; SHFM1D; DLX5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human DLX5 (NP_005212.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY | Uniprot ID | P56178 |
Uniprot Id
P56178
Target Species
Human
Target Name
DLX5
Target Full Name
Homeobox protein DLX-5
Target Function
Transcriptional factor involved in bone development. Acts as an immediate early BMP-responsive transcriptional activator essential for osteoblast differentiation. Stimulates ALPL promoter activity in a RUNX2-independent manner during osteoblast differentiation. Stimulates SP7 promoter activity during osteoblast differentiation. Promotes cell proliferation by up-regulating MYC promoter activity. Involved as a positive regulator of both chondrogenesis and chondrocyte hypertrophy in the endochondral skeleton. Binds to the homeodomain-response element of the ALPL and SP7 promoter. Binds to the MYC promoter. Requires the 5'-TAATTA-3' consensus sequence for DNA-binding.
Target Involvement
Split-hand/foot malformation 1 with sensorineural hearing loss, autosomal recessive (SHFM1D)
Target Subcellular Location
Nucleus.
Target Protein Families
Distal-less homeobox family
Target Synonyms
DLX5Homeobox protein DLX-5
Target Background
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
Notification