Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DLX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 119-293 of human DLX6 (NP_005213.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DLX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 119-293 of human DLX6 (NP_005213.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02382A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DLX6 |
| Target Synonyms | DLX6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 119-293 of human DLX6 (NP_005213.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM | Uniprot ID | P56179 |
Uniprot Id
P56179
Target Species
Human
Target Name
DLX6
Target Full Name
Homeobox protein DLX-6
Target Subcellular Location
Nucleus.
Target Protein Families
Distal-less homeobox family
Target Synonyms
Distal less homeo box 6 ; Distal less homeobox 6; Distal less homeobox gene 6a ; DLX6; DLX6_HUMAN; Homeobox protein DLX-6; MGC125282; MGC125283; MGC125284; MGC125285; OTTHUMP00000205294
Target Background
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
