Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DMT1/SLC11A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human DMT1/SLC11A2 (NP_001167597.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DMT1/SLC11A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human DMT1/SLC11A2 (NP_001167597.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12774A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DMT1/SLC11A2 |
| Target Synonyms | DCT1; DMT1; AHMIO1; NRAMP2; DMT1/SLC11A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BxPC-3, Rat kidney, Rat testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human DMT1/SLC11A2 (NP_001167597.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS | Uniprot ID | P49281 |
Uniprot Id
P49281
Target Species
Human
Target Name
SLC11A2
Target Full Name
Natural resistance-associated macrophage protein 2
Target Function
Important in metal transport, in particular iron. Can also transport manganese, cobalt, cadmium, nickel, vanadium and lead. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution. May serve to import iron into the mitochondria.
Target Involvement
Anemia, hypochromic microcytic, with iron overload 1 (AHMIO1)
Target Subcellular Location
[Isoform 2]: Cell membrane; Multi-pass membrane protein. Early endosome.; Endosome membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
NRAMP family
Target Tissue Specificity
Ubiquitously expressed. Isoform 1 is highly expressed in brain. Isoform 2 is highly expressed in spleen, thymus and pancreas. Isoform 3 and isoform 4 are abundantly expressed in duodenum and kidney.
Target Synonyms
DCT 1; dct-1; DCT1; Divalent cation transporter 1; Divalent metal transporter 1; DMT 1; DMT-1; DMT1; FLJ37416; Natural resistance associated macrophage protein 2; Natural resistance-associated macrophage protein 2; NRAM2_HUMAN; NRAMP 2; NRAMP2; OK/SW-cl.20; Slc11a2; Solute carrier family 11 (proton coupled divalent metal ion transporters) member 2; Solute carrier family 11 member 2
Target Background
This gene encodes a member of the solute carrier family 11 protein family. The product of this gene transports divalent metals and is involved in iron absorption. Mutations in this gene are associated with hypochromic microcytic anemia with iron overload. A related solute carrier family 11 protein gene is located on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
