-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNA Polymerase gamma was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1140-1239 of human DNA Polymerase gamma (P54098) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNA Polymerase gamma was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1140-1239 of human DNA Polymerase gamma (P54098) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16811A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNA Polymerase gamma |
| Target Synonyms | PEO; MDP1; SCAE; MIRAS; POLG1; POLGA; SANDO; MTDPS4A; MTDPS4B; DNA Polymerase gamma | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-29, Mouse brain, Mouse testis, Rat liver, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1140-1239 of human DNA Polymerase gamma (P54098). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP | Uniprot ID | P54098 |
Uniprot Id
P54098
Target Species
Human
Target Name
POLG
Target Full Name
DNA polymerase subunit gamma-1
Target Function
Involved in the replication of mitochondrial DNA. Associates with mitochondrial DNA.
Target Involvement
Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal dominant, 1 (PEOA1); Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive, 1 (PEOB1); Sensory ataxic neuropathy dysarthria and ophthalmoparesis (SANDO); Mitochondrial DNA depletion syndrome 4A (MTDPS4A); Mitochondrial DNA depletion syndrome 4B (MTDPS4B); Leigh syndrome (LS); Spinocerebellar ataxia with epilepsy (SCAE)
Target Subcellular Location
Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid.
Target Protein Families
DNA polymerase type-A family
Target Synonyms
DNA directed DNA polymerase gamma; DNA polymerase subunit gamma 1; DNA polymerase subunit gamma-1; DPOG1_HUMAN; MDP 1; MDP1; Mitochondrial DNA polymerase catalytic subunit; Mitochondrial DNA polymerase gamma; PEO; POLG 1; POLG A; PolG alpha; POLG; PolG-alpha; POLG1; POLGA; Polymerase (DNA directed) gamma; SANDO; SCAE
Target Background
Mitochondrial DNA polymerase is heterotrimeric, consisting of a homodimer of accessory subunits plus a catalytic subunit. The protein encoded by this gene is the catalytic subunit of mitochondrial DNA polymerase. The encoded protein contains a polyglutamine tract near its N-terminus that may be polymorphic. Defects in this gene are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions 1 (PEOA1), sensory ataxic neuropathy dysarthria and ophthalmoparesis (SANDO), Alpers-Huttenlocher syndrome (AHS), and mitochondrial neurogastrointestinal encephalopathy syndrome (MNGIE). Two transcript variants encoding the same protein have been found for this gene.
Notification