-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNA topoisomerase I (TOP1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNA topoisomerase I (TOP1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10338A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNA topoisomerase I (TOP1) |
| Target Synonyms | TOPI; DNA topoisomerase I (TOP1) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, MCF7, Mouse ovary, Mouse spleen, Mouse testis, SKOV3, SW480 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA | Uniprot ID | P11387 |
Uniprot Id
P11387
Target Species
Human
Target Name
TOP1
Target Full Name
DNA topoisomerase 1
Target Function
Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then rotates around the intact phosphodiester bond on the opposing strand, thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone. Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells. Involved in the circadian transcription of the core circadian clock component ARNTL/BMAL1 by altering the chromatin structure around the ROR response elements (ROREs) on the ARNTL/BMAL1 promoter.
Target Involvement
A chromosomal aberration involving TOP1 is found in a form of therapy-related myelodysplastic syndrome. Translocation t(11;20)(p15;q11) with NUP98.
Target Subcellular Location
Nucleus, nucleolus. Nucleus, nucleoplasm. Note=Diffuse nuclear localization with some enrichment in nucleoli. On CPT treatment, cleared from nucleoli into nucleoplasm. Sumoylated forms found in both nucleoplasm and nucleoli.
Target Protein Families
Type IB topoisomerase family
Target Tissue Specificity
Endothelial cells.
Target Research Area
Cancer
Target Synonyms
DNA topoisomerase 1; DNA topoisomerase I; NUP98 fusion gene; TOP 1; TOP I; TOP1; TOP1_HUMAN; TOPI; Topoisomerase (DNA) I; Topoisomerase 1; Topoisomerase1; TopoisomeraseI; Type I DNA topoisomerase
Target Background
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.
Notification