Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNAJC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-100 of human DNAJC4(NP_005519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against DNAJC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-100 of human DNAJC4(NP_005519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of HepG2 cells using DNAJC4 Rabbit pAb at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-08153A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNAJC4 |
| Target Synonyms | HSPF2; MCG18; DANJC4; DNAJC4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-100 of human DNAJC4(NP_005519.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLR | Uniprot ID | Q9NNZ3 |
Uniprot Id
Q9NNZ3
Target Species
Human
Target Name
DNAJC4
Target Full Name
DnaJ homolog subfamily C member 4
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Synonyms
DNAJC4; HSPF2; MCG18; DnaJ homolog subfamily C member 4; DnaJ-like protein HSPF2; Multiple endocrine neoplasia type 1 candidate protein number 18
Target Background
Predicted to be involved in response to unfolded protein. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
