-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNAJC7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-380 of human DNAJC7 (NP_003306.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNAJC7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-380 of human DNAJC7 (NP_003306.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04273A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNAJC7 |
| Target Synonyms | DJ11; DJC7; TPR2; TTC2; DNAJC7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 230-380 of human DNAJC7 (NP_003306.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRK | Uniprot ID | Q99615 |
Uniprot Id
Q99615
Target Species
Human
Target Name
DNAJC7
Target Full Name
DnaJ homolog subfamily C member 7
Target Function
Acts as co-chaperone regulating the molecular chaperones HSP70 and HSP90 in folding of steroid receptors, such as the glucocorticoid receptor and the progesterone receptor. Proposed to act as a recycling chaperone by facilitating the return of chaperone substrates to early stages of chaperoning if further folding is required. In vitro, induces ATP-independent dissociation of HSP90 but not of HSP70 from the chaperone-substrate complexes. Recruits NR1I3 to the cytoplasm.
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton.
Target Synonyms
DJ11; DJC7; DnaJ (Hsp40) homolog subfamily C member 7; DnaJ homolog subfamily C member 7; Dnajc7; DNJC7_HUMAN; Tetratricopeptide repeat domain 2; Tetratricopeptide repeat protein 2; TPR repeat protein 2; TPR2; TTC2
Target Background
This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.
Notification