Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNER was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DNER (NP_620711.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DNER was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DNER (NP_620711.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04974A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNER |
| Target Synonyms | bet; UNQ26; DNER | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HT-29, Mouse brain, Mouse eye, Mouse small intestine | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DNER (NP_620711.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW | Uniprot ID | Q8NFT8 |
Uniprot Id
Q8NFT8
Target Species
Human
Target Name
DNER
Target Full Name
Delta and Notch-like epidermal growth factor-related receptor
Target Function
Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in brain, spinal cord and adrenal gland.
Target Research Area
Neuroscience
Target Synonyms
bet; Brain EGF repeat-containing transmembrane protein; Bret; Delta and Notch-like epidermal growth factor-related receptor; Delta notch like EGF repeat containing transmembrane; Delta/notch like EGF repeat containing; Delta/notch-like EGF-related receptor; Dner; DNER_HUMAN; PRO299; Transmembrane protein Bet; UNQ26
Target Background
Predicted to enable Notch binding activity. Involved in central nervous system development. Located in dendrite; early endosome; and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
