-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNPH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 75-174 of human DNPH1 (O43598) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DNPH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 75-174 of human DNPH1 (O43598) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13228A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNPH1 |
| Target Synonyms | RCL; C6orf108; dJ330M21.3; DNPH1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BT-474 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 75-174 of human DNPH1 (O43598). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT | Uniprot ID | O43598 |
Uniprot Id
O43598
Target Species
Human
Target Name
DNPH1
Target Full Name
5-hydroxymethyl-dUMP N-hydrolase
Target Function
Catalyzes the cleavage of the N-glycosidic bond of deoxyribonucleoside 5'-monophosphates to yield deoxyribose 5-phosphate and a purine or pyrimidine base. Deoxyribonucleoside 5'-monophosphates containing purine bases are preferred to those containing pyrimidine bases.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
2'-deoxynucleoside 5'-phosphate N-hydrolase 1 family
Target Tissue Specificity
Expressed at low levels in brain, colon, lung, peripheral blood leukocytes, placenta, small intestine, and thymus. Expressed at high levels in heart, kidney, liver, skeletal muscle and spleen. Overexpressed in a significant proportion of breast cancers.
Target Synonyms
2' deoxynucleoside 5' phosphate N hydrolase 1; BC048355; c Myc responsive; c Myc responsive protein Rcl; c-Myc-responsive protein Rcl; C6orf108; C76683; Chromosome 6 open reading frame 108; Deoxyribonucleoside 5' monophosphate N glycosidase; Deoxyribonucleoside 5''-monophosphate N-glycosidase; dJ330M21.3; DNPH1; MGC54855; Putative c Myc responsive; Rcl; RCL_HUMAN; RP3 330M21.3
Target Background
This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described.
Notification