-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Dopamine Receptor D3 (DRD3) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 213-329 of human Dopamine Receptor D3 (Dopamine Receptor D3 (DRD3)) (NP_000787.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Dopamine Receptor D3 (DRD3) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 213-329 of human Dopamine Receptor D3 (Dopamine Receptor D3 (DRD3)) (NP_000787.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04967A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Dopamine Receptor D3 (DRD3) |
| Target Synonyms | D3DR; ETM1; FET1; Dopamine Receptor D3 (DRD3) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 213-329 of human Dopamine Receptor D3 (Dopamine Receptor D3 (DRD3)) (NP_000787.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQ | Uniprot ID | P35462 |
Uniprot Id
P35462
Target Species
Human
Target Name
DRD3
Target Full Name
D(3) dopamine receptor
Target Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
Target Involvement
Tremor, hereditary essential 1 (ETM1); Schizophrenia (SCZD)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Both membrane-bound and scattered in the cytoplasm during basal conditions. Receptor stimulation results in the rapid internalization and sequestration of the receptors at the perinuclear area (5 and 15 minutes), followed by the dispersal of the receptors to the membrane (30 minutes). DRD3 and GRK4 co-localize in lipid rafts of renal proximal tubule cells.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Brain.
Target Synonyms
DRD3; D(3 dopamine receptor; Dopamine D3 receptor
Target Background
This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).
Notification