-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DPP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DPP9 (NP_631898.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DPP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DPP9 (NP_631898.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10083A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DPP9 |
| Target Synonyms | DP9; DPLP9; DPRP2; DPP IX; DPRP-2; DPP9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, LO2, OVCAR3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DPP9 (NP_631898.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRKVKKLRLDKENTGSWRSFSLNSEGAERMATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSHR | Uniprot ID | Q86TI2 |
Uniprot Id
Q86TI2
Target Species
Human
Target Name
DPP9
Target Full Name
Dipeptidyl peptidase 9
Target Function
Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2. Acts as an inhibitor of caspase-1-dependent monocyte and macrophage pyroptosis: inhibits pyroptosis by preventing activation of NLRP1 and CARD8 via an unknown mechanism.
Target Subcellular Location
[Isoform 1]: Cytoplasm, cytosol.; [Isoform 2]: Nucleus.
Target Protein Families
Peptidase S9B family, DPPIV subfamily
Target Tissue Specificity
Ubiquitously expressed, with highest levels in liver, heart and muscle, and lowest levels in brain.
Target Research Area
Metabolism
Target Synonyms
Dipeptidyl peptidase 9; Dipeptidyl peptidase IV related protein 2; Dipeptidyl peptidase IV-related protein 2; Dipeptidyl peptidase IX; Dipeptidyl peptidase like protein 9; Dipeptidyl peptidase-like protein 9; Dipeptidylpeptidase 9; Dipeptidylpeptidase IX; DKFZp762F117; DP 9; DP9; DPLP 9; DPLP9; DPP 9; DPP IX; DPP9; DPP9_HUMAN; DPRP 2; DPRP-2; DPRP2; FLJ16073
Target Background
This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. The protein has been shown to have post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Although the activity of this protein is similar to that of dipeptidyl peptidase 4 (DPP4), it does not appear to be membrane bound. In general, dipeptidyl peptidases appear to be involved in the regulation of the activity of their substrates and have been linked to a variety of diseases including type 2 diabetes, obesity and cancer. Several transcript variants of this gene have been described but not fully characterized.
Notification