Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 338-446 of human DRD1 (NP_000785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 338-446 of human DRD1 (NP_000785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11268A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DRD1 |
| Target Synonyms | DADR; DRD1A; DRD1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 338-446 of human DRD1 (NP_000785.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT | Uniprot ID | P21728 |
Uniprot Id
P21728
Target Species
Human
Target Name
DRD1
Target Full Name
D(1A) dopamine receptor
Target Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Detected in caudate, nucleus accumbens and in the olfactory tubercle.
Target Research Area
Neuroscience
Target Synonyms
DRD1; D(1A dopamine receptor; Dopamine D1 receptor
Target Background
This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
