Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DRG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human DRG2 (NP_001379.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DRG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human DRG2 (NP_001379.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06886A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DRG2 |
| Target Synonyms | DRG2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Rat thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human DRG2 (NP_001379.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TKGEVQRSLLEKELESVGIRLNKHKPNIYFKPKKGGGISFNSTVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSPDEFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLA | Uniprot ID | P55039 |
Uniprot Id
P55039
Target Species
Human
Target Name
DRG2
Target Full Name
Developmentally-regulated GTP-binding protein 2
Target Function
Catalyzes the conversion of GTP to GDP through hydrolysis of the gamma-phosphate bond in GTP. When hydroxylated at C-3 of 'Lys-21' by JMJD7, may bind to RNA and play a role in translation.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
TRAFAC class OBG-HflX-like GTPase superfamily, OBG GTPase family
Target Tissue Specificity
Highest levels in skeletal muscle, heart and kidney. Low levels in colon, thymus, spleen, small intestine, lung and Leukocytes.
Target Synonyms
Developmentally regulated GTP binding protein 2; Developmentally-regulated GTP-binding protein 2; DRG 2; DRG-2; drg2; DRG2_HUMAN
Target Background
This gene encodes a GTP-binding protein known to function in the regulation of cell growth and differentiation. Read-through transcripts containing this gene and a downstream gene have been identified, but they are not thought to encode a fusion protein. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
