-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DTNB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 381-560 of human DTNB (NP_899205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DTNB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 381-560 of human DTNB (NP_899205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03295A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DTNB |
| Target Synonyms | DTNB | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 381-560 of human DTNB (NP_899205.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLAAEAGNVTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQAEEGAEEEEEKMQNGKDRG | Uniprot ID | O60941 |
Uniprot Id
O60941
Target Species
Human
Target Name
DTNB
Target Full Name
Dystrobrevin beta
Target Function
Scaffolding protein that assembles DMD and SNTA1 molecules to the basal membrane of kidney cells and liver sinusoids. May function as a repressor of the SYN1 promoter through the binding of repressor element-1 (RE-1), in turn regulates SYN1 expression and may be involved in cell proliferation regulation during the early phase of neural differentiation. May be required for proper maturation and function of a subset of inhibitory synapses.
Target Subcellular Location
Cytoplasm. Cell junction, synapse, postsynaptic density. Cell projection, dendrite. Basal cell membrane. Cell junction, synapse, postsynapse. Nucleus.
Target Protein Families
Dystrophin family, Dystrobrevin subfamily
Target Tissue Specificity
Highly expressed in brain, kidney and pancreas.
Target Synonyms
Beta dystrobrevin; Beta-dystrobrevin; DTN B; DTN-B; Dtnb; DTNB_HUMAN; Dystrobrevin beta; MGC17163; MGC57126
Target Background
This gene encodes dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin.
Notification