-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DTX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human DTX1 (NP_004407.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DTX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human DTX1 (NP_004407.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07471A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DTX1 |
| Target Synonyms | hDx-1; RNF140; DTX1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human DTX1 (NP_004407.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSW | Uniprot ID | Q86Y01 |
Uniprot Id
Q86Y01
Target Species
Human
Target Name
DTX1
Target Full Name
E3 ubiquitin-protein ligase DTX1
Target Function
Functions as a ubiquitin ligase protein in vivo, mediating ubiquitination and promoting degradation of MEKK1, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity. Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Mainly acts as a positive regulator of Notch, but it also acts as a negative regulator, depending on the developmental and cell context. Mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. Involved in neurogenesis, lymphogenesis and myogenesis, and may also be involved in MZB (Marginal zone B) cell differentiation. Promotes B-cell development at the expense of T-cell development, suggesting that it can antagonize NOTCH1.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Predominantly cytoplasmic. Associates with endocytic vesicles. Partially nuclear.
Target Protein Families
Deltex family
Target Tissue Specificity
Widely expressed. Strongly expressed in blood vessel. Also expressed in embryonic nervous system, pancreas, lung, adrenal gland, digestive tube and muscles. Expressed in MZB cells and developing B- and T-cells.
Target Synonyms
Deltex 1; E3 ubiquitin ligase; Deltex; Deltex homolog 1 (Drosophila); Deltex homolog 1; Deltex protein 1; Deltex-1; Deltex1; dtx1; DTX1_HUMAN; E3 ubiquitin protein ligase DTX1; E3 ubiquitin-protein ligase DTX1; FXI-T1; Fxit 1; Fxit1; hDTX1; hDx 1; mDTX1; Protein deltex 1; Protein deltex-1
Target Background
Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity.
Notification