-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DUSP1/MKP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human DUSP1/MKP1 (NP_004408.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DUSP1/MKP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human DUSP1/MKP1 (NP_004408.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14813A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DUSP1/MKP1 |
| Target Synonyms | HVH1; MKP1; CL100; MKP-1; PTPN10; DUSP1/MKP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DUSP1/MKP1 (NP_004408.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGI | Uniprot ID | P28562 |
Uniprot Id
P28562
Target Species
Human
Target Name
DUSP1
Target Full Name
Dual specificity protein phosphatase 1
Target Function
Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle.
Target Subcellular Location
Nucleus.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Target Tissue Specificity
Expressed at high levels in the lung, liver placenta and pancreas. Moderate levels seen in the heart and skeletal muscle. Lower levels found in the brain and kidney.
Target Synonyms
CL 100; CL100; Dual Specificity Phosphatase 1; Dual specificity protein phosphatase 1; Dual specificity protein phosphatase hVH1; DUS1_HUMAN; DUSP 1; Dusp1; HVH1; MAP kinase phosphatase 1; Mitogen-activated protein kinase phosphatase 1; MKP-1; MKP1; Protein tyrosine phosphatase CL100; Protein-tyrosine phosphatase CL100; PTPN10; Serine/threonine specific protein phosphatase; VH1
Target Background
The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. Finally, the encoded protein can make some solid tumors resistant to both chemotherapy and radiotherapy, making it a target for cancer therapy.
Notification