-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DUSP12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-270 of human DUSP12 (NP_009171.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DUSP12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-270 of human DUSP12 (NP_009171.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09596A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DUSP12 |
| Target Synonyms | YVH1; DUSP1; DUSP12 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-270 of human DUSP12 (NP_009171.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFI | Uniprot ID | Q9UNI6 |
Uniprot Id
Q9UNI6
Target Species
Human
Target Name
DUSP12
Target Full Name
Dual specificity protein phosphatase 12
Target Function
Dual specificity phosphatase; can dephosphorylate both phosphotyrosine and phosphoserine or phosphothreonine residues. Can dephosphorylate glucokinase (in vitro). Has phosphatase activity with the synthetic substrate 6,8-difluoro-4-methylumbelliferyl phosphate and other in vitro substrates.
Target Subcellular Location
Nucleus. Cytoplasm, cytosol.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Target Tissue Specificity
Ubiquitous, highest expression in spleen, testis, ovary, and peripheral blood leukocytes and lower expression in liver and lung.
Target Synonyms
Dual specificity phosphatase 12; Dual specificity protein phosphatase 12; Dual specificity tyrosine phosphatase YVH1; DUS12_HUMAN; DUSP 1; DUSP 12; DUSP1; DUSP12; Serine/threonine specific protein phosphatase; TDSP4; YVH 1; YVH1; YVH1 protein tyrosine phosphatase (S. cerevisiae) ortholog; YVH1 protein tyrosine phosphatase ortholog
Target Background
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is the human ortholog of the Saccharomyces cerevisiae YVH1 protein tyrosine phosphatase. It is localized predominantly in the nucleus, and is novel in that it contains, and is regulated by a zinc finger domain.
Notification