-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DUSP19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DUSP19 (NP_543152.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DUSP19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DUSP19 (NP_543152.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03131A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DUSP19 |
| Target Synonyms | SKRP1; DUSP17; LMWDSP3; TS-DSP1; DUSP19 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse skeletal muscle, Mouse uterus, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DUSP19 (NP_543152.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHI | Uniprot ID | Q8WTR2 |
Uniprot Id
Q8WTR2
Target Species
Human
Target Name
DUSP19
Target Full Name
Dual specificity protein phosphatase 19
Target Function
Has a dual specificity toward Ser/Thr and Tyr-containing proteins.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Target Tissue Specificity
Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.
Target Synonyms
Dual specificity phosphatase 19; Dual specificity phosphatase TS DSP1; Dual specificity phosphatase TS-DSP1; Dual specificity protein phosphatase 19; DUS19_HUMAN; DUSP 17; DUSP 19; DUSP17; Dusp19; LMW DSP3; LMW-DSP3; LMWDSP 3; LMWDSP3; Low molecular weight dual specificity phosphatase 3; MGC138210; Protein phosphatase SKRP1; SAPK pathway regulating phosphatase 1; SAPK pathway-regulating phosphatase 1; SKRP 1; SKRP1; Stress activated protein kinase pathway regulating phosphatase 1; Stress-activated protein kinase pathway-regulating phosphatase 1; TS DSP1
Target Background
Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).
Notification