-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DUSP6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 282-381 of human DUSP6 (Q16828) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DUSP6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 282-381 of human DUSP6 (Q16828) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16565A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DUSP6 |
| Target Synonyms | HH19; MKP3; PYST1; DUSP6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse brain, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 282-381 of human DUSP6 (Q16828). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST | Uniprot ID | Q16828 |
Uniprot Id
Q16828
Target Species
Human
Target Name
DUSP6
Target Full Name
Dual specificity protein phosphatase 6
Target Function
Inactivates MAP kinases. Has a specificity for the ERK family. Plays an important role in alleviating chronic postoperative pain. Necessary for the normal dephosphorylation of the long-lasting phosphorylated forms of spinal MAPK1/3 and MAP kinase p38 induced by peripheral surgery, which drives the resolution of acute postoperative allodynia. Also important for dephosphorylation of MAPK1/3 in local wound tissue, which further contributes to resolution of acute pain. Promotes cell differentiation by regulating MAPK1/MAPK3 activity and regulating the expression of AP1 transcription factors.
Target Involvement
Hypogonadotropic hypogonadism 19 with or without anosmia (HH19)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Target Tissue Specificity
Expressed in keratinocytes (at protein level).
Target Research Area
Neuroscience
Target Synonyms
Dual specificity phosphatase 6; Dual specificity phosphatase 6 isoform a; Dual specificity protein phosphatase 6; Dual specificity protein phosphatase PYST1; DUS6_HUMAN; DUSP 6; DUSP 6a; Dusp6; DUSP6a; HH19; MAP kinase phosphatase 3; Mitogen activated protein kinase phosphatase 3; Mitogen-activated protein kinase phosphatase 3; MKP 3; MKP-3; MKP3; PYST 1; PYST1; Serine/threonine specific protein phosphatase
Target Background
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK2, is expressed in a variety of tissues with the highest levels in heart and pancreas, and unlike most other members of this family, is localized in the cytoplasm. Mutations in this gene have been associated with congenital hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been found for this gene.
Notification