Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DVL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 11-110 of human DVL1 (NP_001317240.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DVL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 11-110 of human DVL1 (NP_001317240.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Mouse brain, using DVL1 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-08285A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DVL1 |
| Target Synonyms | DVL; DRS2; DVL1L1; DVL1P1; DVL1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 11-110 of human DVL1 (NP_001317240.1?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTG | Uniprot ID | O14640 |
Uniprot Id
O14640
Target Species
Human
Target Name
DVL1
Target Full Name
Segment polarity protein dishevelled homolog DVL-1
Target Function
Participates in Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Plays a role both in canonical and non-canonical Wnt signaling. Plays a role in the signal transduction pathways mediated by multiple Wnt genes. Required for LEF1 activation upon WNT1 and WNT3A signaling. DVL1 and PAK1 form a ternary complex with MUSK which is important for MUSK-dependent regulation of AChR clustering during the formation of the neuromuscular junction (NMJ).
Target Involvement
Robinow syndrome, autosomal dominant 2 (DRS2)
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol. Cytoplasmic vesicle.
Target Protein Families
DSH family
Target Research Area
Stem cells
Target Synonyms
Dishevelled 1; dishevelled 1 like; Dishevelled; Dishevelled dsh homolog 1; Dishevelled-1; Dishevelled1; DSH homolog 1; Dvl 1; Dvl; Dvl1; DVL1_HUMAN; DVL1L1; MGC54245; Segment polarity protein dishevelled homolog DVL 1; segment polarity protein dishevelled homolog DVL 1 like; Segment polarity protein dishevelled homolog DVL-1; Segment polarity protein dishevelled homolog DVL1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
