Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DVL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-640 of human DVL1 (NP_004412.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DVL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-640 of human DVL1 (NP_004412.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12080A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DVL1 |
| Target Synonyms | DVL; DRS2; DVL1L1; DVL1P1; DVL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, PC-3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 510-640 of human DVL1 (NP_004412.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRE | Uniprot ID | O14640 |
Uniprot Id
O14640
Target Species
Human
Target Name
DVL1
Target Full Name
Segment polarity protein dishevelled homolog DVL-1
Target Function
Participates in Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Plays a role both in canonical and non-canonical Wnt signaling. Plays a role in the signal transduction pathways mediated by multiple Wnt genes. Required for LEF1 activation upon WNT1 and WNT3A signaling. DVL1 and PAK1 form a ternary complex with MUSK which is important for MUSK-dependent regulation of AChR clustering during the formation of the neuromuscular junction (NMJ).
Target Involvement
Robinow syndrome, autosomal dominant 2 (DRS2)
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol. Cytoplasmic vesicle.
Target Protein Families
DSH family
Target Research Area
Stem cells
Target Synonyms
Dishevelled 1; dishevelled 1 like; Dishevelled; Dishevelled dsh homolog 1; Dishevelled-1; Dishevelled1; DSH homolog 1; Dvl 1; Dvl; Dvl1; DVL1_HUMAN; DVL1L1; MGC54245; Segment polarity protein dishevelled homolog DVL 1; segment polarity protein dishevelled homolog DVL 1 like; Segment polarity protein dishevelled homolog DVL-1; Segment polarity protein dishevelled homolog DVL1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
