-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Dynein intermediate chain 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Dynein intermediate chain 1 (Q9UI46) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Dynein intermediate chain 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Dynein intermediate chain 1 (Q9UI46) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14404A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Dynein intermediate chain 1 |
| Target Synonyms | PCD; DIC1; ICS1; CILD1; Dynein intermediate chain 1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Dynein intermediate chain 1 (Q9UI46). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIPASAKAPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQ | Uniprot ID | Q9UI46 |
Uniprot Id
Q9UI46
Target Species
Human
Target Name
DNAI1
Target Full Name
Dynein axonemal intermediate chain 1
Target Function
Part of the dynein complex of respiratory cilia.
Target Involvement
Ciliary dyskinesia, primary, 1 (CILD1); Kartagener syndrome (KTGS)
Target Subcellular Location
Dynein axonemal particle. Cytoplasm, cytoskeleton, cilium axoneme.
Target Protein Families
Dynein intermediate chain family
Target Tissue Specificity
Expressed in respiratory ciliated cells (at protein level).
Target Synonyms
Axonemal dynein intermediate chain 1; Axonemal dynein intermediate chain 2; CILD 1; CILD1; Cytoplasmic dynein 1 intermediate chain 1; Cytoplasmic dynein 1 intermediate chain 2; Cytoplasmic dynein intermediate chain 1; Cytoplasmic dynein intermediate chain 2; DH IC 1; DH IC 2; DIC1; DNAI 1; DNAI 2; DNAI1; DNAI1_HUMAN; DNAI2 ; DNCI 2; DNCI1 ; DNCI2; DNCIC 1; DNCIC 2; DNCIC1; DNCIC2; Dynein axonemal intermediate chain 1; Dynein axonemal intermediate polypeptide 1; Dynein axonemal intermediate polypeptide 2; Dynein cytoplasmic intermediate polypeptide 1; Dynein cytoplasmic intermediate polypeptide 2; Dynein intermediate chain 1 axonemal; Dynein intermediate chain 1 cytosolic; Dynein intermediate chain 1; axonemal; Dynein intermediate chain 2 axonemal; Dynein intermediate chain 2 cytosolic; Dynein intermediate chain DNAI1; IC74; ICS ; ICS1; Immotile cilia syndrome 1; MGC26204; PCD
Target Background
This gene encodes a member of the dynein intermediate chain family. The encoded protein is part of the dynein complex in respiratory cilia. The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generating proteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the base of the dynein arm, help mediate attachment and may also participate in regulating dynein activity. Mutations in this gene result in abnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia and Kartagener syndrome. Alternative splicing results in multiple transcript variants.
Notification