-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DYNLL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DYNLL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10208A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DYNLL1 |
| Target Synonyms | LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1; DYNLL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, A-549 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG | Uniprot ID | P63167 |
Uniprot Id
P63167
Target Species
Human
Target Name
DYNLL1
Target Full Name
Dynein light chain 1, cytoplasmic
Target Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.; Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.; Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.; Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Nucleus. Mitochondrion.
Target Protein Families
Dynein light chain family
Target Tissue Specificity
Ubiquitous. Expressed in testis.
Target Research Area
Apoptosis
Target Synonyms
8 kDa dynein light chain; 8kDLC; Cytoplasmic dynein light polypeptide ; DLC1; DLC8; DNCL1; DNCLC1; DYL1_HUMAN; Dynein ; cytoplasmic; light chain 1; Dynein light chain 1 cytoplasmic; Dynein light chain 1; cytoplasmic; Dynein light chain LC8 type 1; Dynein light chain LC8-type 1; Dynein; cytoplasmic; light polypeptide 1; Dynein; light chain; LC8-type 1; DYNLL1; HDLC1; LC8; LC8a; MGC126137; MGC126138; MGC72986; PIN; Protein inhibitor of neuronal nitric oxide synthase; Protein inhibitor of neuronal NOS
Target Background
Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1, 200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.
Notification